PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00133.18
Common NameAMTR_s00133p00053750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 112aa    MW: 12690.3 Da    PI: 10.07
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00133.18genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP87.62.9e-2731100271
                                      TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                                               g+kd hsk++T   +RdR vRl a++a++f+d+qd+LG+d++sk+ +W +++akpai+el + +  ++s
  evm_27.model.AmTr_v1.0_scaffold00133.18  31 IGRKDGHSKVCTVCWPRDRCVRLAAHTAIQFYDVQDRLGYDRPSKAMDWFINKAKPAIDELKKRTHGQSS 100
                                              589**********************************************************999444442 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.9E-243298IPR005333Transcription factor, TCP
PROSITE profilePS5136927.0093391IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
LENQRRRLSF QSRGGEREIV EVEGGHIVRA IGRKDGHSKV CTVCWPRDRC VRLAAHTAIQ  60
FYDVQDRLGY DRPSKAMDWF INKAKPAIDE LKKRTHGQSS SHGNAPSFWG D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19195KKRTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623141.17e-61PREDICTED: transcription factor PCF5, partial
SwissprotQ8LPR57e-37TCP4_ARATH; Transcription factor TCP4
TrEMBLW1P3H53e-79W1P3H5_AMBTC; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000397864e-37(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.39e-29TCP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]